![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00131559001 | ||||||||
| Common Name | GSBRNA2T00131559001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 101aa MW: 11982.5 Da PI: 9.6569 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 77.4 | 1.8e-24 | 22 | 59 | 6 | 43 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkG 43
+ cprC+s+ntkfCyynnys+sqPry Ck+Crr+Wt G
GSBRNA2T00131559001 22 RVCPRCNSRNTKFCYYNNYSVSQPRYKCKNCRRHWTDG 59
67**********************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 9.0E-13 | 20 | 59 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.8E-22 | 22 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 20.188 | 22 | 77 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MENLNVCVKG HTQLNEEKLP LRVCPRCNSR NTKFCYYNNY SVSQPRYKCK NCRRHWTDGH 60 GRIWGQPNET LTSRTQRDQP FVEIQQVNHH QPFSHVQKIQ * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00131559001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009137161.1 | 5e-34 | PREDICTED: dof zinc finger protein DOF4.4-like | ||||
| Refseq | XP_013741408.1 | 4e-34 | dof zinc finger protein DOF4.4-like | ||||
| Swissprot | Q9SUA9 | 1e-19 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
| TrEMBL | A0A3P5Z3P0 | 2e-61 | A0A3P5Z3P0_BRACM; Uncharacterized protein | ||||
| STRING | Bo1g023790.1 | 2e-47 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1602 | 17 | 89 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21050.1 | 4e-22 | Dof-type zinc finger domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




