PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132295001
Common NameGSBRNA2T00132295001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 188aa    MW: 21872.3 Da    PI: 8.0098
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132295001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41109186178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+ad+s+ak+yh+rhkvCe+h+kapvv +sg  qrfCqqCsrfh+l+efDe+krsCrrrLa+hnerrrk+++
  GSBRNA2T00132295001 109 CCQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHDLREFDEAKRSCRRRLAGHNERRRKSTN 186
                          6**************************************************************************976 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.7E-32103171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.812107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-36108185IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSEILWSNNL STLRSFLTFV SGVLKFSSNV YFHIFSSCYI FHVREEESNI LKMSTRRSNA  60
EGKRSLREMS EEEEDTFEEE DGEEQEEEEA SEKKQKGKAT SSSSNSGVCC QVERCTADMS  120
RAKQYHKRHK VCEFHAKAPV VRISGGYQRF CQQCSRFHDL REFDEAKRSC RRRLAGHNER  180
RRKSTNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-38101183184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.135831e-139bud| seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523, ECO:0000269|PubMed:16914499, ECO:0000269|PubMed:9301089}.
UniprotTISSUE SPECIFICITY: Expressed in vegetative and inflorescence apical meristems, floral meristems, leaf and flower organ primordia, inflorescence stem tissue and to lower extent in roots. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:9301089}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape. {ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:16914499, ECO:0000269|PubMed:9301089}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132295001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:16914499}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411462e-95AC241146.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH072P15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626500.19e-93PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013680760.19e-93squamosa promoter-binding-like protein 3
RefseqXP_013744507.19e-93squamosa promoter-binding-like protein 3
RefseqXP_013744508.19e-93squamosa promoter-binding-like protein 3
SwissprotP930152e-58SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A0D3B4R81e-133A0A0D3B4R8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6ATU21e-133A0A3P6ATU2_BRAOL; Uncharacterized protein
STRINGBo3g027460.11e-134(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-56squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Heidari B,Nemie-Feyissa D,Kangasjärvi S,Lillo C
    Antagonistic regulation of flowering time through distinct regulatory subunits of protein phosphatase 2A.
    PLoS ONE, 2013. 8(7): p. e67987
    [PMID:23976921]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Yu N,Niu QW,Ng KH,Chua NH
    The role of miR156/SPLs modules in Arabidopsis lateral root development.
    Plant J., 2015. 83(4): p. 673-85
    [PMID:26096676]
  5. Lei KJ, et al.
    Modulation of the Phosphate-Deficient Responses by MicroRNA156 and its Targeted SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 3 in Arabidopsis.
    Plant Cell Physiol., 2016. 57(1): p. 192-203
    [PMID:26647245]
  6. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  7. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]
  8. Duan HC, et al.
    ALKBH10B Is an RNA N6-Methyladenosine Demethylase Affecting Arabidopsis Floral Transition.
    Plant Cell, 2017. 29(12): p. 2995-3011
    [PMID:29180595]
  9. Negishi K,Endo M,Abe M,Araki T
    SODIUM POTASSIUM ROOT DEFECTIVE1 regulates FLOWERING LOCUS T expression via the microRNA156-SQUAMOSA PROMOTER BINDING PROTEIN-LIKE3 module in response to potassium conditions.
    Plant Cell Physiol., 2018. 59(2): p. 404-413
    [PMID:29253219]