![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00133043001 | ||||||||
| Common Name | GSBRNA2T00133043001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 173aa MW: 19841.3 Da PI: 7.0161 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.4 | 2.4e-54 | 62 | 157 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+e+lk+yl++yr
GSBRNA2T00133043001 62 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAEQLKKYLNRYR 151
89**************************************************************************************** PP
NF-YB 92 elegek 97
+egek
GSBRNA2T00133043001 152 VIEGEK 157
***997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.4E-53 | 55 | 168 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.79E-40 | 64 | 167 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.9E-28 | 67 | 131 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-19 | 95 | 113 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 98 | 114 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-19 | 114 | 132 | No hit | No description |
| PRINTS | PR00615 | 1.7E-19 | 133 | 151 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MSKGLFIRFI HTNIMFDGWE NYPSFQNPIP RFQNYNFAST SSHHHQHHDG LVVEQEENMV 60 IKEQDRLLPI ANVGRIMKNI LPPNAKISKE AKETMQECVS EFISFVTGEA SDKCHKEKRK 120 TVNGDDICWA MANLGFDDYA EQLKKYLNRY RVIEGEKSNH HGKGEAKSSP DN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-44 | 61 | 151 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-44 | 61 | 151 | 1 | 91 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.22847 | 0.0 | flower | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00133043001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC787665 | 0.0 | KC787665.1 Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013747510.1 | 1e-112 | nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 2e-95 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A397ZCE4 | 1e-111 | A0A397ZCE4_BRACM; Uncharacterized protein | ||||
| TrEMBL | W6D5N7 | 1e-111 | W6D5N7_BRANA; Transcription factor subunit NF-YB5 | ||||
| STRING | Bo4g002290.1 | 1e-110 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 7e-98 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




