![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00138127001 | ||||||||
| Common Name | GSBRNA2T00138127001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 103aa MW: 12266 Da PI: 10.4987 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 95.5 | 3.7e-30 | 22 | 78 | 6 | 62 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
+ cprC+s+ntkfCyynnys+sqPry +CrryWt G alrn+P+ g+ rk k+++
GSBRNA2T00138127001 22 RVCPRCNSKNTKFCYYNNYSVSQPRYKYNNCRRYWTDGRALRNIPIFGSGRKIKRTQ 78
67********************************************99999999875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 5.0E-18 | 20 | 76 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 24.064 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 5.3E-26 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MENLNVCVKR HTQLNEEKLP LRVCPRCNSK NTKFCYYNNY SVSQPRYKYN NCRRYWTDGR 60 ALRNIPIFGS GRKIKRTQRD QPSVEIQQVN HHQPFSHVPK NQ* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00138127001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009137161.1 | 6e-43 | PREDICTED: dof zinc finger protein DOF4.4-like | ||||
| Refseq | XP_013670317.1 | 6e-43 | dof zinc finger protein DOF4.4-like | ||||
| Refseq | XP_013741408.1 | 6e-43 | dof zinc finger protein DOF4.4-like | ||||
| Swissprot | Q9SUA9 | 6e-30 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
| TrEMBL | A0A0D3A4R0 | 6e-70 | A0A0D3A4R0_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6G419 | 6e-70 | A0A3P6G419_BRAOL; Uncharacterized protein | ||||
| STRING | Bo1g023790.1 | 1e-70 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1602 | 17 | 89 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21050.1 | 3e-32 | Dof-type zinc finger domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




