PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00139904001

Common Name

GSBRNA2T00139904001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 194aa MW: 21595.8 Da PI: 10.1843

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00139904001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	76.9	4.8e-24	5	67	64	128
NAM 64 rdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 r++ky++g+r+nra+ +gyWkatg dk++ + + vg+kk Lvfy+g+ p+gekt+W+mheyrl GSBRNA2T00139904001 5 REEKYPNGSRPNRAAGTGYWKATGADKPIGR--PKPVGIKKALVFYSGKPPRGEKTNWIMHEYRL 67 799************************98..789*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	34.198	1	93	IPR003441	NAC domain
SuperFamily	SSF101941	9.94E-29	4	93	IPR003441	NAC domain
Pfam	PF02365	1.1E-10	13	67	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MTLAREEKYP NGSRPNRAAG TGYWKATGAD KPIGRPKPVG IKKALVFYSG KPPRGEKTNW 60 IMHEYRLADV DRSVRKGNSL RLDDWVLCRI YNKKGVIEKR RSEVANGHVM APVMLNFDKP 120 ELIGGGSSCS DQRVVSPEFR CGAKTEPSRC SNALEVPFNY VDAIADNEIV SRLLGGNQMW 180 STLDPLVVRQ RTF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-37	5	99	77	174	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.2304	0.0	flower\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in germinating seeds, roots, leaf veins, open flowers and silique stalks. {ECO:0000269\|PubMed:27388337}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00139904001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966751	0.0	KC966751.1 Brassica napus NAC transcription factor 32 (NAC32.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001302748.1	1e-135	NAC domain-containing protein 2-like
Swissprot	Q9CAR0	2e-95	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A078HU56	1e-134	A0A078HU56_BRANA; BnaCnng09850D protein
TrEMBL	A0A0A7BX29	1e-134	A0A0A7BX29_BRANA; NAC transcription factor 32
STRING	Bra008309.1-P	1e-133	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM190	28	276

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	1e-97	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]