![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00142876001 | ||||||||
| Common Name | GSBRNA2T00142876001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 83aa MW: 9812.15 Da PI: 10.5802 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.9 | 3.5e-11 | 20 | 56 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+l ++v+ +G+ +W+ Ia++m+ gRt+k+ ++rw++
GSBRNA2T00142876001 20 SQLMELVTVYGPQNWNHIAEKMQ-GRTGKSRRLRWFNQ 56
6899*******************.***********996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.737 | 1 | 61 | IPR017930 | Myb domain |
| CDD | cd00167 | 2.74E-6 | 19 | 55 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.8E-20 | 20 | 75 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 1.0E-9 | 21 | 74 | No hit | No description |
| SuperFamily | SSF46689 | 3.26E-13 | 21 | 79 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 4.368 | 58 | 82 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MNQRRSREVL GFVVEDIGES QLMELVTVYG PQNWNHIAEK MQGRTGKSRR LRWFNQLDPR 60 INKRAFSPEE EERLLAAHRA FW* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in organ boundaries. {ECO:0000269|PubMed:19542355}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00142876001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF272732 | 5e-54 | AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013593005.1 | 9e-38 | PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44 | ||||
| Swissprot | Q9SEZ4 | 1e-27 | MY105_ARATH; Transcription factor MYB105 | ||||
| TrEMBL | A0A0D3DBG2 | 9e-54 | A0A0D3DBG2_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6E3Q3 | 9e-54 | A0A3P6E3Q3_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g087170.1 | 2e-54 | (Brassica oleracea) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G29020.1 | 1e-34 | myb domain protein 110 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




