![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00142938001 | ||||||||
| Common Name | GSBRNA2T00142938001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 71aa MW: 7920.33 Da PI: 11.9932 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.8 | 1.4e-28 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
rienk++rqvtfskRr+g+ KK +E+SvLCda+va+i+fs++gkl+eys
GSBRNA2T00142938001 10 RIENKIRRQVTFSKRRTGLVKKVQEISVLCDADVALIVFSPKGKLFEYS 58
8***********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.927 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.7E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.29E-28 | 2 | 66 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MGRGRVQLRR IENKIRRQVT FSKRRTGLVK KVQEISVLCD ADVALIVFSP KGKLFEYSAG 60 SRLRQVVGSS * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 5e-18 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_B | 5e-18 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_C | 5e-18 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_D | 5e-18 | 1 | 59 | 1 | 59 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.26790 | 6e-85 | leaf| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in tendrils and flowers. {ECO:0000269|PubMed:15247405}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00142938001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP001314 | 8e-68 | AP001314.1 Arabidopsis thaliana genomic DNA, chromosome 3, BAC clone:T6J22. | |||
| GenBank | AY141238 | 8e-68 | AY141238.1 Arabidopsis thaliana MADS-box protein AGL79 mRNA, complete cds. | |||
| GenBank | CP002686 | 8e-68 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009151758.1 | 5e-36 | PREDICTED: truncated transcription factor CAULIFLOWER A | ||||
| Refseq | XP_018481832.1 | 5e-36 | PREDICTED: truncated transcription factor CAULIFLOWER A-like | ||||
| Refseq | XP_022544001.1 | 6e-36 | truncated transcription factor CAULIFLOWER A-like | ||||
| Refseq | XP_022561302.1 | 6e-36 | truncated transcription factor CAULIFLOWER A-like | ||||
| Refseq | XP_022561335.1 | 6e-36 | truncated transcription factor CAULIFLOWER A-like | ||||
| Swissprot | D7SMN6 | 3e-30 | FULL_VITVI; Agamous-like MADS-box protein FUL-L | ||||
| TrEMBL | A0A0D3DBL2 | 2e-41 | A0A0D3DBL2_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g088660.1 | 3e-42 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30260.1 | 3e-38 | AGAMOUS-like 79 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




