![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00144103001 | ||||||||
| Common Name | GSBRNA2T00144103001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 86aa MW: 10238 Da PI: 10.3789 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 65.2 | 1.3e-20 | 2 | 80 | 296 | 374 |
GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
+v+a eg er++r et+++W+ r+ +aGFk+++l+++++k+ k l+r+ + + + +++++++++ +Wk+r ++++ +W+
GSBRNA2T00144103001 2 SVIASEGPERFARPETYKQWQVRILRAGFKTAKLNKQIVKEGKELIRERYHKDFVIDNDNHWMFECWKGRVIYALPCWK 80
69************************************************888*************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 12.694 | 1 | 60 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 4.5E-18 | 2 | 80 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MSVIASEGPE RFARPETYKQ WQVRILRAGF KTAKLNKQIV KEGKELIRER YHKDFVIDND 60 NHWMFECWKG RVIYALPCWK PAKKQ* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves, sepals, stamen and pistil, and in the quiescent center of root meristem. {ECO:0000269|PubMed:18500650}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00144103001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009150374.1 | 7e-50 | PREDICTED: scarecrow-like protein 30 isoform X1 | ||||
| Swissprot | Q9SNB8 | 4e-48 | SCL30_ARATH; Scarecrow-like protein 30 | ||||
| TrEMBL | A0A0D3BHK1 | 3e-56 | A0A0D3BHK1_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g132680.1 | 4e-57 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM15599 | 6 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G46600.3 | 6e-51 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




