![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00150717001 | ||||||||
| Common Name | GSBRNA2T00150717001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 175aa MW: 19316 Da PI: 9.7887 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 121.9 | 2.2e-38 | 58 | 116 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
++k+++cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grrk k
GSBRNA2T00150717001 58 PDKIIACPRCKSMETKFCYFNNYNVKQPRHFCRGCQRYWTAGGALRNVPVGAGRRKAKP 116
68999***************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-28 | 57 | 115 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 4.0E-32 | 60 | 115 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.717 | 62 | 116 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 64 | 100 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010214 | Biological Process | seed coat development | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 175 aa Download sequence Send to blast |
MATQDSQGIK LFGKTITFNA SNITTTTIKK EVHQQQPELQ ATTDVRSSST DLTVEKRPDK 60 IIACPRCKSM ETKFCYFNNY NVKQPRHFCR GCQRYWTAGG ALRNVPVGAG RRKAKPPGRV 120 GGFAEFLGAA TGAVDQVELD ALLVEEWRAA ASHGGFRHDF PVKRLRCYTD GQSC* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.10142 | 0.0 | seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00166 | DAP | Transfer from AT1G29160 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00150717001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC021043 | 1e-154 | AC021043.4 Arabidopsis thaliana chromosome I BAC F28N24 genomic sequence, complete sequence. | |||
| GenBank | BT029990 | 1e-154 | BT029990.1 Arabidopsis thaliana At1g29160 mRNA, complete cds. | |||
| GenBank | CP002684 | 1e-154 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013626298.1 | 1e-129 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
| Swissprot | P68350 | 1e-105 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | A0A397YD72 | 1e-128 | A0A397YD72_BRACM; Uncharacterized protein | ||||
| STRING | Bo3g143780.1 | 1e-128 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2809 | 26 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 1e-107 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




