![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00151174001 | ||||||||
| Common Name | GSBRNA2T00151174001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 148aa MW: 15825 Da PI: 9.6702 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 59.5 | 4.3e-19 | 39 | 73 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ Cgt+kTplWR gp g+k+LCnaCG++ rkk++
GSBRNA2T00151174001 39 CVDCGTSKTPLWRGGPAGPKSLCNACGIKSRKKRQ 73
*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.189 | 33 | 69 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 1.1E-11 | 33 | 94 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.43E-12 | 34 | 76 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 2.9E-15 | 37 | 73 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 3.09E-12 | 38 | 72 | No hit | No description |
| Pfam | PF00320 | 6.2E-17 | 39 | 73 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 39 | 64 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSMTEETKTT KLESAGETSD VENGNCSSSG SGGDTKKTCV DCGTSKTPLW RGGPAGPKSL 60 CNACGIKSRK KRQAAHGIKQ EDNNNKIKKN KSSNDLALDD QTVKSKIKTG TEDLPVMKRS 120 VVEKKRLWMK MGEEERAAVL LMALSCG* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.10797 | 0.0 | microspore-derived embryo| seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00151174001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189632 | 6e-92 | AC189632.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS003O10, complete sequence. | |||
| GenBank | AC232469 | 6e-92 | AC232469.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026A07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013737390.1 | 2e-76 | GATA transcription factor 17-like | ||||
| Refseq | XP_013738174.1 | 2e-76 | GATA transcription factor 17-like | ||||
| Swissprot | Q9LIB5 | 9e-50 | GAT17_ARATH; GATA transcription factor 17 | ||||
| TrEMBL | A0A3P5ZYV3 | 9e-74 | A0A3P5ZYV3_BRACM; Uncharacterized protein | ||||
| STRING | Bra012742.1-P | 3e-74 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13816 | 16 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G16141.1 | 1e-54 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




