PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00156208001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 84aa    MW: 9471 Da    PI: 9.4256
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00156208001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.6e-191461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  GSBRNA2T00156208001 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                         79******************************99************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.093965IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-221260IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002492.1E-171461IPR001005SANT/Myb domain
SuperFamilySSF466893.73E-211581IPR009057Homeodomain-like
CDDcd001672.51E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-56182IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MGRPPCCEKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQA*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}.
UniprotTISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}.
UniprotTISSUE SPECIFICITY: Specifically expressed in guard cells (PubMed:16005291, PubMed:18036199, PubMed:22088138, PubMed:23828545). Present in seedlings, leaves, stems and flowers (PubMed:16005291, PubMed:22088138). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:18036199, ECO:0000269|PubMed:22088138, ECO:0000269|PubMed:23828545}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00156208001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}.
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628951e-111AF062895.1 Arabidopsis thaliana putative transcription factor (MYB60) mRNA, complete cds.
GenBankAK1174691e-111AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBankAY5195511e-111AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBankBT0050741e-111BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028761366.12e-57transcription factor MYB60-like
SwissprotB3VTV73e-57MYB60_VITVI; Transcription factor MYB60
SwissprotQ8GYP59e-58MYB60_ARATH; Transcription factor MYB60
TrEMBLA0A2N9I3I41e-56A0A2N9I3I4_FAGSY; Uncharacterized protein
STRINGXP_008240570.19e-57(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.14e-60myb domain protein 60
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Galbiati M, et al.
    Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells.
    Plant J., 2008. 53(5): p. 750-62
    [PMID:18036199]
  3. Rusconi F, et al.
    The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells.
    J. Exp. Bot., 2013. 64(11): p. 3361-71
    [PMID:23828545]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Kim D,Ntui VO,Xiong L
    Arabidopsis YAK1 regulates abscisic acid response and drought resistance.
    FEBS Lett., 2016. 590(14): p. 2201-9
    [PMID:27264339]