PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00158036001

Common Name

GSBRNA2T00158036001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

Whirly

Protein Properties

Length: 122aa MW: 13648.3 Da PI: 9.9442

Description

Whirly family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00158036001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Whirly	32.4	1.7e-10	69	104	1	36
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglll 36 s+yk+kaal+v+++ p+f++l+sg++kl+++G+ GSBRNA2T00158036001 69 SIYKGKAALTVEPRTPEFVSLNSGAFKLSKDGFSTA 104 7*******************************9665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.30.31.10	5.5E-13	59	107	IPR009044	ssDNA-binding transcriptional regulator
SuperFamily	SSF54447	1.26E-12	63	113	IPR009044	ssDNA-binding transcriptional regulator
Pfam	PF08536	3.7E-7	70	102	IPR013742	Plant transcription factor

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MSVFRKTTYT KVFQNFISRL WSNLGYHGRL PCKSSSRQTD YFEKQRFGDS SSSSENGEGG 60 PARFYVGHSI YKGKAALTVE PRTPEFVSLN SGAFKLSKDG FSTASFCSCS WCKAIRLEQE 120 R*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4koo_A	1e-21	57	113	2	58	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_B	1e-21	57	113	2	58	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_C	1e-21	57	113	2	58	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_D	1e-21	57	113	2	58	Single-stranded DNA-binding protein WHY1, chloroplastic
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269\|PubMed:14960277, ECO:0000269\|PubMed:17217467, ECO:0000269\|PubMed:19666500, ECO:0000269\|PubMed:19669906, ECO:0000269\|PubMed:20551348, ECO:0000269\|PubMed:21911368}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00158036001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269\|PubMed:14960277, ECO:0000269\|PubMed:19669906}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013602028.1	7e-38	PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
Refseq	XP_013657384.1	7e-38	single-stranded DNA-binding protein WHY1, chloroplastic
Swissprot	Q9M9S3	7e-34	WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBL	A0A078JMC5	2e-36	A0A078JMC5_BRANA; BnaCnng51250D protein
TrEMBL	A0A0D3DPN9	4e-36	A0A0D3DPN9_BRAOL; Uncharacterized protein
TrEMBL	A0A3N6U4Y7	6e-37	A0A3N6U4Y7_BRACR; Uncharacterized protein
TrEMBL	A0A3P6G8M8	3e-36	A0A3P6G8M8_BRAOL; Uncharacterized protein (Fragment)
STRING	Bo8g066030.1	7e-37	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G14410.1	1e-33	ssDNA-binding transcriptional regulator

Publications ? help Back to Top
Lepage É,Zampini É,Brisson N Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis. Plant Physiol., 2013. 163(2): p. 867-81 [PMID:23969600] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Carella P,Wilson DC,Cameron RK Some things get better with age: differences in salicylic acid accumulation and defense signaling in young and mature Arabidopsis. Front Plant Sci, 2014. 5: p. 775 [PMID:25620972] Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans. Genome Res., 2015. 25(5): p. 645-54 [PMID:25800675] Ren Y,Li Y,Jiang Y,Wu B,Miao Y Phosphorylation of WHIRLY1 by CIPK14 Shifts Its Localization and Dual Functions in Arabidopsis. Mol Plant, 2017. 10(5): p. 749-763 [PMID:28412544] Karpinska B,Alomrani SO,Foyer CH Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling. Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018. [PMID:28808105] Huang D,Lin W,Deng B,Ren Y,Miao Y Dual-Located WHIRLY1 Interacting with LHCA1 Alters Photochemical Activities of Photosystem I and Is Involved in Light Adaptation in Arabidopsis. Int J Mol Sci, 2018. [PMID:29112140] Guan Z,Wang W,Yu X,Lin W,Miao Y Comparative Proteomic Analysis of Coregulation of CIPK14 and WHIRLY1/3 Mediated Pale Yellowing of Leaves in Arabidopsis. Int J Mol Sci, 2018. [PMID:30065159]