![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00158445001 | ||||||||
| Common Name | GSBRNA2T00158445001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 134aa MW: 14813.5 Da PI: 6.2359 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.7 | 4.7e-25 | 61 | 119 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y+++ed+++++++sws+++nsfvv+d++ f+ ++Lp++Fkh+nf+SFvRQLn+Y
GSBRNA2T00158445001 61 FLTKTYDLVEDSRTNDVVSWSQDKNSFVVWDPQAFSMTLLPRFFKHNNFSSFVRQLNTY 119
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.2E-27 | 54 | 119 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.5E-23 | 56 | 119 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.0E-22 | 57 | 131 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.7E-21 | 61 | 119 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-14 | 61 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-14 | 99 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-14 | 112 | 124 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MDRSYTCIKE VFPTGINDSP SPPSSSTSSY LHSTSMAPND PATLNSPQPI EGLHESGPPP 60 FLTKTYDLVE DSRTNDVVSW SQDKNSFVVW DPQAFSMTLL PRFFKHNNFS SFVRQLNTYT 120 PPLPPSSLSS KKL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d8k_B | 2e-19 | 59 | 119 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_B | 2e-19 | 59 | 119 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_D | 2e-19 | 59 | 119 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_F | 2e-19 | 59 | 119 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_H | 2e-19 | 59 | 119 | 3 | 63 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00158445001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189327 | 0.0 | AC189327.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037A01, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013623226.1 | 4e-83 | PREDICTED: heat stress transcription factor A-6b-like | ||||
| Refseq | XP_013739498.2 | 3e-83 | heat stress transcription factor A-6b-like | ||||
| Swissprot | Q9LUH8 | 1e-49 | HFA6B_ARATH; Heat stress transcription factor A-6b | ||||
| TrEMBL | A0A0D3BCU0 | 1e-81 | A0A0D3BCU0_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6ANK0 | 7e-82 | A0A3P6ANK0_BRAOL; Uncharacterized protein | ||||
| STRING | Bo3g081420.1 | 2e-82 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1256 | 28 | 99 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 1e-50 | heat shock transcription factor A6B | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




