![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr11P05710_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 166aa MW: 18053 Da PI: 6.3545 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.1 | 1.9e-56 | 27 | 123 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
v+eqdr+lPianv+rimk++lP+nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal tlGf+dyvep+k yl
GSMUA_Achr11P05710_001 27 VKEQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALNTLGFDDYVEPMKRYL 113
58************************************************************************************* PP
NF-YB 88 kkyrelegek 97
+kyre+eg++
GSMUA_Achr11P05710_001 114 QKYREMEGDR 123
********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.5E-54 | 24 | 140 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.49E-41 | 30 | 140 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.8E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.6E-20 | 61 | 79 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.6E-20 | 80 | 98 | No hit | No description |
| PRINTS | PR00615 | 1.6E-20 | 99 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 166 aa Download sequence Send to blast |
MADNLGSSME SDGHHNYAGA ASGDGGVKEQ DRLLPIANVG RIMKQILPQN AKISKEAKET 60 MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDICWALNTL GFDDYVEPMK RYLQKYREME 120 GDRAAGGGGH STKASSSSDA RDQPSAGAHF MFDPSERSKP SASRGF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-45 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-45 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970198 | 9e-82 | EU970198.1 Zea mays clone 342117 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009382552.1 | 1e-122 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O82248 | 6e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | Q75IZ7 | 4e-56 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | M0RPQ1 | 1e-121 | M0RPQ1_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr11P05710_001 | 1e-122 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-59 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




