![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr11P24630_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 131aa MW: 14592.8 Da PI: 8.0533 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.3 | 1.7e-56 | 29 | 121 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
vreqdrflPian++rimkk+lPanaki+kdaket+qecvsefisfvtseasd+cq+ekrktingddllwa+atlGfe+y+eplk+yl
GSMUA_Achr11P24630_001 29 VREQDRFLPIANIIRIMKKALPANAKIAKDAKETMQECVSEFISFVTSEASDRCQKEKRKTINGDDLLWAMATLGFEEYIEPLKLYL 115
69************************************************************************************* PP
NF-YB 88 kkyrel 93
+kyre+
GSMUA_Achr11P24630_001 116 QKYREV 121
****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-53 | 27 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.71E-39 | 32 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.0E-29 | 35 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.6E-23 | 63 | 81 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 66 | 82 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.6E-23 | 82 | 100 | No hit | No description |
| PRINTS | PR00615 | 6.6E-23 | 101 | 119 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MAEAPPASPG GGGGSHESGE HSPRAGAGVR EQDRFLPIAN IIRIMKKALP ANAKIAKDAK 60 ETMQECVSEF ISFVTSEASD RCQKEKRKTI NGDDLLWAMA TLGFEEYIEP LKLYLQKYRE 120 VLCFLRIAFR F |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-47 | 29 | 120 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009384907.1 | 5e-85 | PREDICTED: nuclear transcription factor Y subunit B-like | ||||
| Swissprot | Q8VYK4 | 9e-62 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | M0RV43 | 1e-92 | M0RV43_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr11P24630_001 | 2e-93 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-60 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




