PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr11P25100_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

MYB

Protein Properties

Length: 183aa MW: 21399.3 Da PI: 9.1344

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr11P25100_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.3	6.2e-17	38	83	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+++v q+G+ +W++Ia+++ gRt+k+c++rw++ GSMUA_Achr11P25100_001 38 RGHWRPAEDAKLKELVSQHGPQHWNLIAEKIA-GRTGKSCRLRWFNQ 83 899***************************.*********996 PP
2	Myb_DNA-binding	54.7	2.3e-17	90	134	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++++eE+e+l a++++G++ W++Iar ++ gRt++ +k++w+ GSMUA_Achr11P25100_001 90 KKAFSEEEEERLFVAHRLYGNR-WALIARIFP-GRTDNAVKNHWHVT 134 679*****************.*****.*********975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.819	33	84	IPR017930	Myb domain
SMART	SM00717	6.9E-14	37	86	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.99E-28	38	131	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.8E-26	39	90	IPR009057	Homeodomain-like
Pfam	PF13921	9.2E-16	41	101	No hit	No description
CDD	cd00167	7.05E-12	41	82	No hit	No description
PROSITE profile	PS51294	25.778	85	139	IPR017930	Myb domain
SMART	SM00717	3.9E-15	89	137	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.6E-20	91	138	IPR009057	Homeodomain-like
CDD	cd00167	5.08E-11	92	132	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MGFFAPVAPP FVHGLTGEHE NHGKVEEDDQ RQHKLCARGH WRPAEDAKLK ELVSQHGPQH 60 WNLIAEKIAG RTGKSCRLRW FNQLDPRINK KAFSEEEEER LFVAHRLYGN RWALIARIFP 120 GRTDNAVKNH WHVTMARKQR EQCNDASSYI CTETTCRKKN HKRLHPSYDV LQPWHCSMLC 180 SDL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-34	36	138	5	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009384963.1	1e-104	PREDICTED: myb-like protein Q isoform X1
Refseq	XP_018675625.1	1e-104	PREDICTED: transcriptional activator Myb-like isoform X2
Swissprot	Q5NBM8	9e-65	CSA_ORYSJ; Transcription factor CSA
TrEMBL	M0RV90	1e-136	M0RV90_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr11P25100_001	1e-137	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	1e-63	myb domain protein 105

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]