![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr2P09110_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 119aa MW: 13061.7 Da PI: 9.1045 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 118.6 | 2.4e-37 | 45 | 101 | 2 | 58 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
+e+al+cprC+s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grr+
GSMUA_Achr2P09110_001 45 PEEALPCPRCKSKKTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRRG 101
78999**************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 7.2E-30 | 47 | 100 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 1.0E-23 | 49 | 101 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.848 | 49 | 103 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 51 | 87 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MAEDEEAPSF KLFGTVILKG DGLGKEEEAA QPATETAGVV EAVEPEEALP CPRCKSKKTK 60 FCYFNNYNVN QPRHFCKACH RYWTAGGALR NVPVGAGRRR GCPTNRRSTW TGRRQGGGS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK071083 | 6e-42 | AK071083.1 Oryza sativa Japonica Group cDNA clone:J023076F14, full insert sequence. | |||
| GenBank | AP003409 | 6e-42 | AP003409.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1131G08. | |||
| GenBank | AP014957 | 6e-42 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012609 | 6e-42 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
| GenBank | HQ858825 | 6e-42 | HQ858825.1 Oryza sativa Japonica Group isolate UT1323 C2C2-Dof transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009392426.2 | 3e-45 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
| Swissprot | O22967 | 3e-35 | CDF4_ARATH; Cyclic dof factor 4 | ||||
| TrEMBL | M0S6F2 | 8e-83 | M0S6F2_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr2P09110_001 | 1e-83 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6495 | 28 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34140.1 | 8e-33 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




