PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr2P22510_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

GRAS

Protein Properties

Length: 260aa MW: 27416.9 Da PI: 5.6236

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr2P22510_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	49.5	7.6e-16	162	220	1	59
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvse 59 lv++L++cAeav++++l++a+al++++ l +++g +m+++a yf+eALa+r++r +++ GSMUA_Achr2P22510_001 162 LVHALMACAEAVQQESLKAADALVKQITVLTTSQGGAMRKVAGYFAEALARRIYRPQPH 220 689****************************************************5554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01129	2.2E-30	19	96	No hit	No description
Pfam	PF12041	2.0E-35	19	90	IPR021914	Transcriptional factor DELLA, N-terminal
PROSITE profile	PS50985	11.926	136	260	IPR005202	Transcription factor GRAS
Pfam	PF03514	2.6E-13	162	220	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 260 aa Download sequence Send to blast
MEHEKGKDTM GAEEDGGVDE LLAALGYKVR SSDMADVAQK LEQLEKAMGS STAANDDALF 60 SHLASDTVHY NPSDIFTWVD NILSELNAPP TPLAPPPPPP PPALPIVYGS DAQSVLAPSP 120 RDRKRLKVCS SPPSSSSTTD AAKSDKALPV VVVDTQEAGI RLVHALMACA EAVQQESLKA 180 ADALVKQITV LTTSQGGAMR KVAGYFAEAL ARRIYRPQPH RGVGCSSQDS AALDNILHDC 240 SGQPSFRPSP SAPVARPRSA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2zsh_B	3e-25	10	89	15	91	DELLA protein GAI
2zsi_B	3e-25	10	89	15	91	DELLA protein GAI
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression in seeds. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Compared to other DELLA proteins, it is the most sensitive to GA application. No effect of the BOI proteins on its stability. Its activity is probably regulated by other phytohormones such as auxin and ethylene, attenuation of auxin transport delaying its GA-induced degradation. {ECO:0000269\|PubMed:11606551, ECO:0000269\|PubMed:11606552, ECO:0000269\|PubMed:12610625, ECO:0000269\|PubMed:14615596, ECO:0000269\|PubMed:14973286, ECO:0000269\|PubMed:15128937, ECO:0000269\|PubMed:16034591, ECO:0000269\|PubMed:17933900, ECO:0000269\|PubMed:20093430, ECO:0000269\|PubMed:9490740}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ153042	3e-95	DQ153042.1 Musa AAB Group GRAS transcription factor (GAI1) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009390245.1	1e-139	PREDICTED: DELLA protein SLR1-like
Swissprot	Q9SLH3	8e-60	RGA_ARATH; DELLA protein RGA
TrEMBL	M0SA92	0.0	M0SA92_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr2P22510_001	0.0	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP998	38	138

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G14920.1	6e-52	GRAS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Stewart Lilley JL,Gan Y,Graham IA,Nemhauser JL The effects of DELLAs on growth change with developmental stage and brassinosteroid levels. Plant J., 2013. 76(1): p. 165-73 [PMID:23834248] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Oh E, et al. Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl. Elife, 2015. [PMID:24867218] Gallego-Giraldo C, et al. Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis. Plant J., 2014. 79(6): p. 1020-1032 [PMID:24961590] Fukazawa J, et al. DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis. Plant Cell, 2014. 26(7): p. 2920-38 [PMID:25035403] Tan L,Rong W,Luo H,Chen Y,He C The Xanthomonas campestris effector protein XopDXcc8004 triggers plant disease tolerance by targeting DELLA proteins. New Phytol., 2014. 204(3): p. 595-608 [PMID:25040905] Urano D,Dong T,Bennetzen JL,Jones AM Adaptive evolution of signaling partners. Mol. Biol. Evol., 2015. 32(4): p. 998-1007 [PMID:25568345] Montenegro-Johnson TD, et al. Digital Single-Cell Analysis of Plant Organ Development Using 3DCellAtlas. Plant Cell, 2015. 27(4): p. 1018-33 [PMID:25901089] Kim SI, et al. E3 SUMO ligase AtSIZ1 positively regulates SLY1-mediated GA signalling and plant development. Biochem. J., 2015. 469(2): p. 299-314 [PMID:26008766] Marín-de la Rosa N, et al. Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Moubayidin L, et al. A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] Xie Y,Tan H,Ma Z,Huang J DELLA Proteins Promote Anthocyanin Biosynthesis via Sequestering MYBL2 and JAZ Suppressors of the MYB/bHLH/WD40 Complex in Arabidopsis thaliana. Mol Plant, 2016. 9(5): p. 711-721 [PMID:26854848] Shi H,Wei Y,Wang Q,Reiter RJ,He C Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis. J. Pineal Res., 2016. 60(3): p. 373-9 [PMID:26887824] Lee SA, et al. Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] Liu B,De Storme N,Geelen D Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis. Plant Physiol., 2017. 173(1): p. 338-353 [PMID:27621423] Jiang K, et al. Substituted Phthalimide AC94377 Is a Selective Agonist of the Gibberellin Receptor GID1. Plant Physiol., 2017. 173(1): p. 825-835 [PMID:27899534] Matsuoka K, et al. Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls. Plant Cell Physiol., 2016. 57(12): p. 2620-2631 [PMID:27986917] Zhang Y, et al. GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation. Plant Cell Rep., 2017. 36(4): p. 557-569 [PMID:28275852] Zheng H, et al. MLK1 and MLK2 Coordinate RGA and CCA1 Activity to Regulate Hypocotyl Elongation in Arabidopsis thaliana. Plant Cell, 2018. 30(1): p. 67-82 [PMID:29255112] Yamazaki K, et al. Suppression of DELLA signaling induces procambial cell formation in culture. Plant J., 2018. 94(1): p. 48-59 [PMID:29383774] Liu B,De Storme N,Geelen D Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling. Front Plant Sci, 2018. 9: p. 91 [PMID:29459879] Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana. Plant Cell Rep., 2018. 37(6): p. 901-912 [PMID:29541883] Zhang Y, et al. DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6. Plant Cell Rep., 2018. 37(7): p. 981-992 [PMID:29574486]