PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr4P03920_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

NF-YC

Protein Properties

Length: 136aa MW: 15487.3 Da PI: 5.5784

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr4P03920_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	45.3	1.9e-14	45	82	1	35
NF-YC 1 qlksfwekq...iekatdfknhelPlarikkilkaded 35 ql++fw++q ie++tdf+nh+lPlarikki+kaded GSMUA_Achr4P03920_001 45 QLQMFWADQyreIEQTTDFRNHSLPLARIKKIMKADED 82 89***99999***********************9 PP
2	NF-YC	38.2	3.1e-12	81	113	69	101
NF-YC 69 nkrrtlkksdiaaavtrtdifdflvdivprdel 101 +rrtl+k+diaaa++rtd+fdfl+divpr+e GSMUA_Achr4P03920_001 81 EDRRTLQKNDIAAAISRTDVFDFLIDIVPREEG 113 579***************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.55E-12	36	104	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	6.8E-8	59	82	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	8.2E-9	83	110	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MDQQPGHPAP PVIGVATGVP YAAASGTYQA YQNLYHQQQQ QQQQQLQMFW ADQYREIEQT 60 TDFRNHSLPL ARIKKIMKAD EDRRTLQKND IAAAISRTDV FDFLIDIVPR EEGKEDVAHA 120 LGAPPSDPLS YYYVPK

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	82	88	RRTLQKN

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT009224	3e-35	BT009224.1 Triticum aestivum clone wle1n.pk0076.h7:fis, full insert mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009394692.1	1e-81	PREDICTED: nuclear transcription factor Y subunit C-6-like
Swissprot	Q8LCG7	5e-33	NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
TrEMBL	M0SKV9	1e-95	M0SKV9_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr4P03920_001	2e-96	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56170.2	2e-33	nuclear factor Y, subunit C2

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li S, et al. HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] Mei X, et al. Identification and characterization of paternal-preferentially expressed gene NF-YC8 in maize endosperm. Mol. Genet. Genomics, 2015. 290(5): p. 1819-31 [PMID:25851237] Baud S, et al. Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed. Plant Physiol., 2016. 171(2): p. 1099-112 [PMID:27208266] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]