![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr4P15140_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 149aa MW: 16195.5 Da PI: 9.5566 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 121.8 | 2.4e-38 | 45 | 101 | 5 | 61 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
al+cprC+s++tkfCy+nny+++qPr+fCkaC+ryWt+GG+lrnvPvG+grrk +++
GSMUA_Achr4P15140_001 45 ALPCPRCKSKETKFCYFNNYNVNQPRHFCKACHRYWTAGGTLRNVPVGAGRRKVRRA 101
679**************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 1.3E-31 | 46 | 100 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.341 | 46 | 100 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 5.0E-24 | 46 | 99 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 48 | 84 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MGEVDEAASI KLFGAVILKE DRQAKEKKEA QDEAAAAREA AAAVALPCPR CKSKETKFCY 60 FNNYNVNQPR HFCKACHRYW TAGGTLRNVP VGAGRRKVRR APHGGVSATA GPATCVLEHP 120 SPPYLAARWL LRPEAPPRAD YGTFNGGLC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ969263 | 6e-52 | AJ969263.1 Hordeum vulgare dof17 gene for dof zinc finger protein 17, cultivated variety Bomi. | |||
| GenBank | AK360617 | 6e-52 | AK360617.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1121P17. | |||
| GenBank | AK365055 | 6e-52 | AK365055.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030J14. | |||
| GenBank | HG670306 | 6e-52 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009395706.1 | 3e-80 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
| Swissprot | O22967 | 2e-34 | CDF4_ARATH; Cyclic dof factor 4 | ||||
| TrEMBL | M0SP29 | 1e-105 | M0SP29_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr4P15140_001 | 1e-106 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6495 | 28 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 7e-33 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




