![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr4P17890_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 112aa MW: 13479.3 Da PI: 10.2377 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.4 | 6.1e-33 | 38 | 96 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
GSMUA_Achr4P17890_001 38 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHS 96
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.1E-34 | 23 | 96 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.75E-29 | 30 | 96 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.92 | 33 | 95 | IPR003657 | WRKY domain |
| SMART | SM00774 | 7.7E-38 | 38 | 97 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 6.5E-26 | 39 | 95 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MHTRRWRSSS LEKGKVKVRR KMREPRFCFQ TRSDVDVLDD GYKWRKYGQK VVKNSLHPRS 60 YYRCTHSNCR VKKRVERLSE DCRMVITTYE GRHTHSPCDD ASSSEHECFS SF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 5e-27 | 29 | 95 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 5e-27 | 29 | 95 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00618 | PBM | Transfer from AT2G44745 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009397047.1 | 5e-74 | PREDICTED: probable WRKY transcription factor 12 isoform X2 | ||||
| Swissprot | Q93WY4 | 6e-63 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
| TrEMBL | M0SPV2 | 7e-77 | M0SPV2_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr4P17890_001 | 1e-77 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G44745.1 | 2e-65 | WRKY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




