PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr5P15570_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

LBD

Protein Properties

Length: 51aa MW: 5747.6 Da PI: 8.3831

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr5P15570_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	51.4	3.1e-16	10	51	1	42
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnv 42 aCaaCk++rr+C++dC+la yfpa+qpk+f+n h lF+++n+ GSMUA_Achr5P15570_001 10 ACAACKYQRRRCPADCPLAAYFPADQPKQFQNCHCLFSVHNI 51 7**************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	14.707	9	51	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	2.0E-14	10	51	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MTVKGDTNNA CAACKYQRRR CPADCPLAAY FPADQPKQFQ NCHCLFSVHN I

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018673497.1	3e-27	PREDICTED: LOB domain-containing protein 27-like
Swissprot	Q9STS6	3e-21	LBD27_ARATH; LOB domain-containing protein 27
TrEMBL	M0SYT6	4e-30	M0SYT6_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr5P15570_001	6e-31	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP15459	13	16

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47870.1	1e-23	LOB domain-containing protein 27

Publications ? help Back to Top
Kim MJ,Kim M,Kim J Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis. Plant Signal Behav, 2015. 10(8): p. e1044193 [PMID:26252070] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]