![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr5P28380_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 139aa MW: 15414.6 Da PI: 6.5206 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.3 | 1.6e-56 | 29 | 121 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
vreqdrflPian++rimkk+lPanaki+kdaket+qecvsefisfvtseasd+cq+ekrktingddllwa+atlGfe+y+eplk+yl+
GSMUA_Achr5P28380_001 29 VREQDRFLPIANIIRIMKKALPANAKIAKDAKETMQECVSEFISFVTSEASDRCQKEKRKTINGDDLLWAMATLGFEEYIEPLKLYLQ 116
69************************************************************************************** PP
NF-YB 89 kyrel 93
kyre+
GSMUA_Achr5P28380_001 117 KYREV 121
***98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.6E-53 | 27 | 121 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.15E-39 | 32 | 122 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.3E-29 | 35 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.5E-23 | 63 | 81 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 66 | 82 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.5E-23 | 82 | 100 | No hit | No description |
| PRINTS | PR00615 | 7.5E-23 | 101 | 119 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MAEAPPASPG GGGGSHESGE QSPRAGVGVR EQDRFLPIAN IIRIMKKALP ANAKIAKDAK 60 ETMQECVSEF ISFVTSEASD RCQKEKRKTI NGDDLLWAMA TLGFEEYIEP LKLYLQKYRE 120 VLCSFRGYVL PFNVFSDHS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 8e-48 | 25 | 120 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ862214 | 2e-64 | KJ862214.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018682020.1 | 2e-84 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_018682021.1 | 2e-84 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Swissprot | Q8VYK4 | 5e-63 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | M0T2G2 | 1e-99 | M0T2G2_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr5P28380_001 | 1e-100 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-60 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




