![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr6P02820_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 169aa MW: 18731.8 Da PI: 7.6258 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 178.7 | 5.3e-56 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89
+eqdrflP+anvsrimk+ lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGf+ yv plk+yl+k
GSMUA_Achr6P02820_001 33 KEQDRFLPVANVSRIMKRSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFDSYVGPLKAYLNK 120
79************************************************************************************** PP
NF-YB 90 yrelegek 97
yre+egek
GSMUA_Achr6P02820_001 121 YRETEGEK 128
******97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.0E-52 | 29 | 134 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.73E-40 | 35 | 142 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.1E-27 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.2E-19 | 66 | 84 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.2E-19 | 85 | 103 | No hit | No description |
| PRINTS | PR00615 | 2.2E-19 | 104 | 122 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 169 aa Download sequence Send to blast |
MKGRRSRHHL GTGGSHQLVS DDESGHASDS SPKEQDRFLP VANVSRIMKR SLPANAKISK 60 EAKETVQECV SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFDSY VGPLKAYLNK 120 YRETEGEKNL MARHGEPPSN EPDDASPAIP SFAASGFYSV GEAWDQRKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-46 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-46 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB124648 | 7e-92 | AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath. | |||
| GenBank | AB124649 | 7e-92 | AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath. | |||
| GenBank | AY062182 | 7e-92 | AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds. | |||
| GenBank | CP012616 | 7e-92 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. | |||
| GenBank | CT837794 | 7e-92 | CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence. | |||
| GenBank | KR815350 | 7e-92 | KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
| GenBank | KR815351 | 7e-92 | KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
| GenBank | LC016712 | 7e-92 | LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong. | |||
| GenBank | LC016713 | 7e-92 | LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3. | |||
| GenBank | LC016714 | 7e-92 | LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha. | |||
| GenBank | LC016715 | 7e-92 | LC016715.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Basilanon. | |||
| GenBank | LC016716 | 7e-92 | LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai. | |||
| GenBank | LC016718 | 7e-92 | LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba. | |||
| GenBank | LC016719 | 7e-92 | LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe. | |||
| GenBank | LC016721 | 7e-92 | LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009403188.1 | 1e-125 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | Q0J7P4 | 1e-61 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
| TrEMBL | M0T3N0 | 1e-124 | M0T3N0_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr6P02820_001 | 1e-124 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 6e-64 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




