![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr8P16920_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 113aa MW: 12835.8 Da PI: 10.2355 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.9 | 2.1e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd lv +++++G+g+Wk+++ g+ R+ k+c++rw +yl
GSMUA_Achr8P16920_001 15 KGPWTPEEDIVLVSYIQEHGPGNWKAVPTNTGLIRCSKSCRLRWTNYL 62
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 29.7 | 1.5e-09 | 68 | 99 | 1 | 34 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34
rg++T +E++l++++ ++lG++ W++Ia++++
GSMUA_Achr8P16920_001 68 RGNFTDQEEKLIIHLQALLGNR-WAAIASYLP-E 99
89********************.********9.3 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-23 | 7 | 65 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.25 | 10 | 66 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.16E-26 | 12 | 103 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.7E-12 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.0E-16 | 15 | 62 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.07E-11 | 17 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-14 | 66 | 100 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 0.0073 | 67 | 107 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 9.668 | 67 | 113 | IPR017930 | Myb domain |
| Pfam | PF00249 | 2.2E-8 | 68 | 100 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.71E-5 | 70 | 100 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MGRPPPRCDR DGVKKGPWTP EEDIVLVSYI QEHGPGNWKA VPTNTGLIRC SKSCRLRWTN 60 YLRPGIKRGN FTDQEEKLII HLQALLGNRW AAIASYLPER GQIMTSRTTG IHI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 2e-19 | 13 | 100 | 25 | 111 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009412676.1 | 2e-63 | PREDICTED: myb-related protein 306-like | ||||
| Refseq | XP_021765881.1 | 3e-63 | myb-related protein 306-like | ||||
| Refseq | XP_021765882.1 | 3e-63 | myb-related protein 306-like | ||||
| Swissprot | P81392 | 1e-60 | MYB06_ANTMA; Myb-related protein 306 | ||||
| Swissprot | Q9SCU7 | 1e-60 | MYB30_ARATH; Transcription factor MYB30 | ||||
| TrEMBL | M0TR45 | 1e-78 | M0TR45_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr8P16920_001 | 2e-79 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP229 | 38 | 296 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28910.1 | 6e-63 | myb domain protein 30 | ||||




