![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr8P21910_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 118aa MW: 13176.9 Da PI: 8.3316 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 122.7 | 1.5e-38 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
mkk+lP nakisk+aket+qec+sefi+f+t+ea+d cq+++rktingdd++ a+ tlG++dy+++++ yl++y+e e++
GSMUA_Achr8P21910_001 1 MKKALPPNAKISKQAKETMQECASEFIGFITGEAADSCQKNNRKTINGDDICAAMKTLGLDDYADAMRRYLHRYKEHEEK 80
9***************************************************************************9975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 1.6E-19 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 5.9E-36 | 1 | 86 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.86E-28 | 1 | 84 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 9.0E-13 | 19 | 37 | No hit | No description |
| PRINTS | PR00615 | 9.0E-13 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 9.0E-13 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MKKALPPNAK ISKQAKETMQ ECASEFIGFI TGEAADSCQK NNRKTINGDD ICAAMKTLGL 60 DDYADAMRRY LHRYKEHEEK ATSRDHNKIA CIDVVDELSV SKTSSSRRHL FPTNPSVG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009414194.1 | 2e-84 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 1e-34 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 2e-34 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | M0TSJ4 | 1e-83 | M0TSJ4_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr8P21910_001 | 2e-84 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 4e-37 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




