![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_Achr9P07230_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 115aa MW: 13710.6 Da PI: 10.1897 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 107.6 | 6.1e-34 | 38 | 96 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +ve+tYeg Hnh+
GSMUA_Achr9P07230_001 38 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGIVETTYEGVHNHT 96
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 5.4E-34 | 23 | 96 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 8.76E-30 | 30 | 96 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.207 | 33 | 98 | IPR003657 | WRKY domain |
| SMART | SM00774 | 9.6E-40 | 38 | 97 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.6E-27 | 39 | 95 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MLLIFLFVPN SSRTQGKIWK NMQKQRYAFH TRSHVDILDD GYRWRKYGQK AVKNNKFPRS 60 YYRCTHQGCN VKKQVQRLSK DEGIVETTYE GVHNHTTEKP IDSFGHVLEQ MQIYS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-27 | 28 | 95 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-27 | 28 | 95 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK354853 | 9e-38 | AK354853.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1012D01. | |||
| GenBank | AK364290 | 9e-38 | AK364290.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2023H16. | |||
| GenBank | DQ840411 | 9e-38 | DQ840411.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 12 (WRKY12) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009416583.1 | 4e-66 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 3e-48 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | M0TY82 | 2e-82 | M0TY82_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_Achr9P07230_001 | 4e-83 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 1e-50 | WRKY DNA-binding protein 75 | ||||




