PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr9P20230_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

SBP

Protein Properties

Length: 94aa MW: 9873.06 Da PI: 8.6099

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr9P20230_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	74.9	1.3e-23	48	94	2	48
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 CqvegC++dl+ ak y+ rhkvC +hskap+v+v+gleqrfCqqCsr GSMUA_Achr9P20230_001 48 CQVEGCNVDLTGAKAYYCRHKVCAMHSKAPKVMVAGLEQRFCQQCSR 94 **********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	2.2E-24	43	94	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	19.597	45	94	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	3.92E-22	47	94	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.9E-19	48	94	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MDSSSFKASA TSSSSSDPPH GLKFGRKIYF DGGSGGSGSS SETPSAPCQV EGCNVDLTGA 60 KAYYCRHKVC AMHSKAPKVM VAGLEQRFCQ QCSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	3e-15	38	94	1	57	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305\|PubMed:12202040}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009418241.1	2e-38	PREDICTED: squamosa promoter-binding-like protein 17
Swissprot	Q9M2Q6	1e-24	SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBL	M0U1Y2	3e-62	M0U1Y2_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr9P20230_001	5e-63	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP25180	5	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57920.1	5e-23	squamosa promoter binding protein-like 15

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Morea EG, et al. Functional and evolutionary analyses of the miR156 and miR529 families in land plants. BMC Plant Biol., 2016. 16: p. 40 [PMID:26841873] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584]