PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr9P20940_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

M-type_MADS

Protein Properties

Length: 102aa MW: 11729.5 Da PI: 9.5531

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr9P20940_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.7	3.5e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvt+skRr+gi+KKA+EL vLCdaev++i+fsstgk+ ey+s GSMUA_Achr9P20940_001 9 KKIENPTNRQVTYSKRRTGIMKKAKELTVLCDAEVSIIMFSSTGKFSEYCS 59 78***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.6E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.679	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.06E-37	2	91	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.58E-41	2	80	No hit	No description
PRINTS	PR00404	3.6E-28	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.4E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.6E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.6E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MGRGKIEIKK IENPTNRQVT YSKRRTGIMK KAKELTVLCD AEVSIIMFSS TGKFSEYCSP 60 STDTKKIFDR YQQVSGTNLW SAQYEARTTF ISEFHVCICF HS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-19	1	89	1	81	MEF2C
5f28_B	1e-19	1	89	1	81	MEF2C
5f28_C	1e-19	1	89	1	81	MEF2C
5f28_D	1e-19	1	89	1	81	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269\|PubMed:12506001, ECO:0000269\|PubMed:12905025, ECO:0000269\|PubMed:14558657}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY739700	3e-71	AY739700.1 Elaeis guineensis MADS box transcription factor (DEF1) mRNA, complete cds.
GenBank	KF142649	3e-71	KF142649.1 Elaeis guineensis truncated DEF-like protein mRNA, complete cds.
GenBank	KR347486	3e-71	KR347486.1 Elaeis guineensis kDEF1 (kDEF1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009418316.1	9e-57	PREDICTED: MADS-box transcription factor 16-like
Swissprot	Q944S9	1e-46	MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBL	M0U253	2e-70	M0U253_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr9P20940_001	3e-71	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5728	35	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	6e-39	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Chen ZX, et al. Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] Zhang Q, et al. Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Xiao H, et al. STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Ohmori S,Tabuchi H,Yatou O,Yoshida H Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]