![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSMUA_AchrUn_randomP01300_001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 88aa MW: 10099.8 Da PI: 4.7587 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 59.8 | 9.1e-19 | 3 | 51 | 1 | 49 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
lppGfrF+Ptd elv++yL++k++g+ +++evi+e+di+k+ePwdLp
GSMUA_AchrUn_randomP01300_001 3 LPPGFRFRPTDAELVNHYLEEKIAGRIKSADEVISEIDICKSEPWDLPG 51
79****************************99***************94 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.84E-17 | 2 | 53 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 18.174 | 3 | 88 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.0E-9 | 4 | 69 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MELPPGFRFR PTDAELVNHY LEEKIAGRIK SADEVISEID ICKSEPWDLP GDLPAPKSYL 60 LPLLHCLIHL FVCDLWSVFV FPIFFGKN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009389904.1 | 8e-21 | PREDICTED: uncharacterized protein LOC103976433 isoform X1 | ||||
| Refseq | XP_009389911.1 | 9e-21 | PREDICTED: uncharacterized protein LOC103976433 isoform X2 | ||||
| Refseq | XP_009397631.1 | 1e-20 | PREDICTED: NAC domain-containing protein 14-like isoform X1 | ||||
| Refseq | XP_018686838.1 | 1e-20 | PREDICTED: NAC domain-containing protein 14 isoform X3 | ||||
| Swissprot | B5X570 | 6e-16 | NAC14_ARATH; NAC domain-containing protein 14 | ||||
| TrEMBL | M0U5E2 | 1e-57 | M0U5E2_MUSAM; Uncharacterized protein | ||||
| STRING | GSMUA_AchrUn_randomP01300_001 | 2e-58 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP16506 | 9 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G33060.2 | 1e-17 | NAC 014 | ||||




