![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01000175001 | ||||||||
| Common Name | VITISV_040997 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 63aa MW: 6991.33 Da PI: 11.2723 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 79.1 | 3.1e-25 | 9 | 53 | 1 | 45 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
k+ienk rqvtf+kRrng+lKKA+E+S+LCd+eva++ fs++gk
GSVIVT01000175001 9 KKIENKAVRQVTFAKRRNGLLKKAYEISTLCDIEVALLAFSPSGK 53
78*****************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.7E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 26.338 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.29E-25 | 2 | 59 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.0E-24 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRQRVEIKK IENKAVRQVT FAKRRNGLLK KAYEISTLCD IEVALLAFSP SGKPTIFGGK 60 KR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6byy_B | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6byy_C | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6byy_D | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6bz1_A | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6bz1_B | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6bz1_C | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| 6bz1_D | 2e-15 | 1 | 53 | 1 | 53 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM462251 | 1e-101 | AM462251.2 Vitis vinifera contig VV78X147749.46, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010652754.1 | 2e-34 | PREDICTED: MADS-box transcription factor 8 isoform X1 | ||||
| Refseq | XP_019076584.1 | 2e-34 | PREDICTED: agamous-like MADS-box protein AGL66 isoform X2 | ||||
| Swissprot | Q1PFC2 | 2e-23 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | A0A438FBZ0 | 7e-34 | A0A438FBZ0_VITVI; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | D7TTB7 | 9e-37 | D7TTB7_VITVI; Uncharacterized protein | ||||
| STRING | VIT_07s0129g00650.t01 | 1e-37 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77980.1 | 9e-26 | AGAMOUS-like 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01000175001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




