PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01004375001

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

NF-YB

Protein Properties

Length: 115aa MW: 12261.4 Da PI: 3.8899

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01004375001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	58.1	2.2e-18	27	65	2	40
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvs 40 reqdr+lPianvsrimkk+lPanakiskdaketvq+ + GSVIVT01004375001 27 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQDIIK 65 89*********************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	5.07E-12	8	65	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	7.4E-16	23	64	IPR009072	Histone-fold
Pfam	PF00808	4.0E-9	32	64	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MADSDNDSGG AQNNNSGGNV NSELSAREQD RLLPIANVSR IMKKALPANA KISKDAKETV 60 QDIIKDTSTD QGRIIRWVAA VDLPPVVLAV VAEPPPEDPD EDEEVDEDDD GFCM*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.10309	2e-91	inflorescence\| leaf\| root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM478196	1e-98	AM478196.1 Vitis vinifera contig VV78X161128.3, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022758913.1	8e-29	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	3e-23	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A0D2TG81	2e-26	A0A0D2TG81_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8L7P2	2e-26	A0A1U8L7P2_GOSHI; nuclear transcription factor Y subunit B-3-like
TrEMBL	A0A2P5QEF2	1e-26	A0A2P5QEF2_GOSBA; Uncharacterized protein
TrEMBL	A0A438H614	1e-27	A0A438H614_VITVI; Nuclear transcription factor Y subunit B-3
STRING	Gorai.007G166100.1	3e-27	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	3e-19	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	GSVIVT01004375001

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]