![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01007064001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 181aa MW: 19747.3 Da PI: 8.2493 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 106 | 2.1e-33 | 38 | 92 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt +LHerFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
GSVIVT01007064001 38 KPRLRWTADLHERFVDAVTQLGGANKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 92
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.43 | 35 | 95 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-32 | 35 | 93 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.91E-17 | 38 | 94 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 3.7E-24 | 38 | 93 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 5.4E-8 | 40 | 91 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 5.9E-9 | 136 | 158 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 181 aa Download sequence Send to blast |
MFPGLIQVQP HESIVPQEDL RGSNHRGDPC LVLTSDPKPR LRWTADLHER FVDAVTQLGG 60 ANKATPKAIM RTMGVKGLTL FHLKSHLQKY RLGKQSGKDM GEAPKDGISA SYLSESPGTS 120 NSSPNLPTSD INEGYEVKEA LRVQMEVQSK LHLQVEVKAN SGARSQENKA SCMPSEERGE 180 * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 7e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 7e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 7e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 7e-20 | 38 | 94 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 9e-20 | 38 | 94 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.26936 | 0.0 | cell culture| flower | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FQ396399 | 1e-152 | FQ396399.1 Vitis vinifera clone SS0AFA10YA14. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019074068.1 | 1e-112 | PREDICTED: protein PHR1-LIKE 2 | ||||
| Swissprot | Q94A57 | 6e-58 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
| TrEMBL | F6HD65 | 1e-113 | F6HD65_VITVI; Uncharacterized protein | ||||
| STRING | VIT_00s0475g00030.t01 | 1e-114 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP78 | 17 | 262 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24120.1 | 3e-60 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01007064001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




