![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01007677001 | ||||||||
| Common Name | VIT_17s0000g09010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 156aa MW: 16809.8 Da PI: 7.3386 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 86.3 | 4.2e-27 | 10 | 77 | 1 | 68 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAear 68
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++ l e +a
GSVIVT01007677001 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVERLQKELDAA 77
7*********************************************************9887666655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 19.221 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 9.2E-27 | 10 | 83 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 156 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVERL QKELDAANAD LIRYACNEMS SQLPSPSLVR STSRRIGNEG GGSYFQNPGY 120 SHPYSLPWDD NPSGNMNESG GGGGGGSMTT TLLSQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-43 | 9 | 89 | 10 | 119 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-43 | 9 | 89 | 10 | 119 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.16411 | 1e-135 | bud | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM447719 | 1e-133 | AM447719.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X240773.7, clone ENTAV 115. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010663111.1 | 3e-95 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_010663112.1 | 3e-95 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Refseq | XP_019081921.1 | 3e-95 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
| Swissprot | Q9FML4 | 8e-46 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | F6GSI8 | 3e-99 | F6GSI8_VITVI; Uncharacterized protein | ||||
| STRING | VIT_17s0000g09010.t01 | 1e-100 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 2e-48 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01007677001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




