![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01008980001 | ||||||||
| Common Name | VIT_18s0001g04810 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 98aa MW: 11538.4 Da PI: 9.901 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 77.6 | 9.3e-25 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
rie+k rqv+fs+R++g++KKA+ELSvLCd+++a+i+f ++g+l +s
GSVIVT01008980001 10 RIEDKATRQVSFSRRKKGLIKKAYELSVLCDIDIALIMFPPSGRLTQFS 58
8*********************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.5E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 27.46 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.76E-29 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0025501 | developmental stage | fruit formation stage | ||||
| PO:0025502 | developmental stage | fruit ripening stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MGRGKQEMRR IEDKATRQVS FSRRKKGLIK KAYELSVLCD IDIALIMFPP SGRLTQFSGK 60 KRMEEVFTRY MHLTDEEREE YALELLVQFA FERVWSS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6byy_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6c9l_A | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM486084 | 7e-97 | AM486084.2 Vitis vinifera contig VV78X084760.4, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019071852.1 | 4e-59 | PREDICTED: agamous-like MADS-box protein AGL66 | ||||
| Swissprot | Q1PFC2 | 1e-30 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | E0CRG3 | 1e-64 | E0CRG3_VITVI; Uncharacterized protein | ||||
| STRING | VIT_18s0001g04810.t01 | 2e-65 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77950.2 | 2e-33 | AGAMOUS-like 67 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01008980001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




