![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01009846001 | ||||||||
| Common Name | VIT_18s0001g13740 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 132aa MW: 14841 Da PI: 10.103 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 36 | 1.6e-11 | 15 | 73 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
kr++r NR +A rs +RK +++eLe kv +L++e ++L l l+ +a+l+s +
GSVIVT01009846001 15 KRAKRILANRQSAARSKERKVRYMAELEHKVHTLQTETTTLSHLLTLLQRDSAELTSRN 73
9*****************************************************99977 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 2.1E-14 | 11 | 75 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.312 | 13 | 76 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 3.4E-11 | 15 | 69 | No hit | No description |
| Pfam | PF00170 | 4.7E-10 | 15 | 73 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 3.66E-11 | 15 | 66 | No hit | No description |
| CDD | cd14703 | 5.52E-13 | 16 | 49 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MGNEKLAEIA LVDPKRAKRI LANRQSAARS KERKVRYMAE LEHKVHTLQT ETTTLSHLLT 60 LLQRDSAELT SRNNELKLRI QAMEQEAQFR DALKEALTLE VHRLQLLGTA EPSGGKVFFS 120 SLCFVRDSGP N* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.2062 | 1e-154 | fruit | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM450475 | 2e-67 | AM450475.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X202426.4, clone ENTAV 115. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002280542.1 | 3e-90 | PREDICTED: transcription factor RF2b isoform X2 | ||||
| Swissprot | Q9MA75 | 1e-41 | VIP1_ARATH; Transcription factor VIP1 | ||||
| TrEMBL | F6GZR6 | 7e-77 | F6GZR6_VITVI; Uncharacterized protein | ||||
| STRING | VIT_18s0001g13740.t01 | 1e-77 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP126 | 17 | 181 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38900.3 | 3e-36 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01009846001 |




