PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009846001
Common NameVIT_18s0001g13740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family bZIP
Protein Properties Length: 132aa    MW: 14841 Da    PI: 10.103
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009846001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1361.6e-111573563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                       kr++r   NR +A rs +RK  +++eLe kv +L++e ++L   l  l+  +a+l+s +
  GSVIVT01009846001 15 KRAKRILANRQSAARSKERKVRYMAELEHKVHTLQTETTTLSHLLTLLQRDSAELTSRN 73
                       9*****************************************************99977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-141175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3121376IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-111569No hitNo description
PfamPF001704.7E-101573IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.66E-111566No hitNo description
CDDcd147035.52E-131649No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MGNEKLAEIA LVDPKRAKRI LANRQSAARS KERKVRYMAE LEHKVHTLQT ETTTLSHLLT  60
LLQRDSAELT SRNNELKLRI QAMEQEAQFR DALKEALTLE VHRLQLLGTA EPSGGKVFFS  120
SLCFVRDSGP N*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.20621e-154fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4504752e-67AM450475.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X202426.4, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280542.13e-90PREDICTED: transcription factor RF2b isoform X2
SwissprotQ9MA751e-41VIP1_ARATH; Transcription factor VIP1
TrEMBLF6GZR67e-77F6GZR6_VITVI; Uncharacterized protein
STRINGVIT_18s0001g13740.t011e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-36bZIP family protein
Publications ? help Back to Top
  1. Wang Y, et al.
    The putative Agrobacterium transcriptional activator-like virulence protein VirD5 may target T-complex to prevent the degradation of coat proteins in the plant cell nucleus.
    New Phytol., 2014. 203(4): p. 1266-81
    [PMID:24865527]
  2. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  3. Chen J, et al.
    ZmbZIP91 regulates expression of starch synthesis-related genes by binding to ACTCAT elements in their promoters.
    J. Exp. Bot., 2016. 67(5): p. 1327-38
    [PMID:26689855]
  4. Tsugama D,Liu S,Takano T
    VIP1 is very important/interesting protein 1 regulating touch responses of Arabidopsis.
    Plant Signal Behav, 2016. 11(6): p. e1187358
    [PMID:27171129]
  5. Tsugama D,Liu S,Takano T
    The bZIP Protein VIP1 Is Involved in Touch Responses in Arabidopsis Roots.
    Plant Physiol., 2016. 171(2): p. 1355-65
    [PMID:27208231]
  6. Takeo K,Ito T
    Subcellular localization of VIP1 is regulated by phosphorylation and 14-3-3 proteins.
    FEBS Lett., 2017. 591(13): p. 1972-1981
    [PMID:28542772]
  7. Wang L,Lacroix B,Guo J,Citovsky V
    The Agrobacterium VirE2 effector interacts with multiple members of the Arabidopsis VIP1 protein family.
    Mol. Plant Pathol., 2018. 19(5): p. 1172-1183
    [PMID:28802023]