![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01010260001 | ||||||||
| Common Name | LOC100261324, VIT_01s0010g01910 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 153aa MW: 17264.5 Da PI: 5.844 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 154.3 | 2.2e-48 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
eqd +lPianv+rimk++ P akisk+aket+qecvsefi fvt+eas+kcqre+rkt+ngdd++wal+ lGf+d++e++ yl+kyre+e+
GSVIVT01010260001 3 DEQDLLLPIANVGRIMKQIPPPSAKISKEAKETMQECVSEFIKFVTGEASEKCQRENRKTVNGDDICWALSALGFDDHAEAIVRYLHKYREFER 96
599******************************************************************************************9 PP
NF-YB 96 ek 97
e+
GSVIVT01010260001 97 ER 98
96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.8E-47 | 3 | 110 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.28E-36 | 5 | 102 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.9E-27 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.2E-15 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 1.2E-15 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 1.2E-15 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MADEQDLLLP IANVGRIMKQ IPPPSAKISK EAKETMQECV SEFIKFVTGE ASEKCQRENR 60 KTVNGDDICW ALSALGFDDH AEAIVRYLHK YREFERERPN QRVQNEVDST RTKSGASDYK 120 CIQAGKQTET PTPILLFEVT DQNGNRSLTK PF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM437217 | 0.0 | AM437217.2 Vitis vinifera contig VV78X191396.14, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002269496.1 | 1e-112 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 9e-51 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A438EJL1 | 1e-110 | A0A438EJL1_VITVI; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | D7TAH3 | 1e-110 | D7TAH3_VITVI; Uncharacterized protein | ||||
| STRING | VIT_01s0010g01910.t01 | 1e-111 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 4e-53 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01010260001 |
| Entrez Gene | 100261324 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




