PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01011415001

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

ZF-HD

Protein Properties

Length: 90aa MW: 9671.73 Da PI: 8.2229

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01011415001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.1	7.5e-32	26	82	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa +Gg+avDGC+Efm+s geegt++al+CaACgCHRnFH reve+e GSVIVT01011415001 26 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTSSALTCAACGCHRNFHLREVETE 82 79************************9.999******************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-28	1	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	5.1E-30	27	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.7E-26	28	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.784	29	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MRKRQVVLRR DEPSRSSANS SFTVRSVRYG ECQKNHAAGV GGYAVDGCRE FMASGEEGTS 60 SALTCAACGC HRNFHLREVE TESIIGTSN*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.1029	1e-134	fruit\| inflorescence\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM482956	1e-133	AM482956.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X096604.7, clone ENTAV 115.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010661067.1	8e-54	PREDICTED: mini zinc finger protein 2
Swissprot	Q9LJW5	1e-36	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	F6H5T5	2e-52	F6H5T5_VITVI; Uncharacterized protein
STRING	VIT_14s0108g00810.t01	3e-53	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	4e-39	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	GSVIVT01011415001

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]