PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01012777001

Common Name

VIT_18s0117g00210

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

MYB

Protein Properties

Length: 238aa MW: 26645.9 Da PI: 7.4281

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01012777001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	8e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l++++++ G g+W++ ++ g+ R++k+c++rw +yl GSVIVT01012777001 14 RGAWTKEEDDRLIEYIRMNGHGSWRSLPKAAGLLRCGKSCRLRWINYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	57.8	2.5e-18	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T +Edel+++++k+lG++ W++Ia +++ gRt++++k++w+++ GSVIVT01012777001 67 RGNFTIDEDELIIKLHKLLGNK-WSLIAGRLP-GRTDNEIKNHWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.873	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	6.74E-30	13	108	IPR009057	Homeodomain-like
SMART	SM00717	1.7E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.38E-9	16	61	No hit	No description
PROSITE profile	PS51294	28.353	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-26	65	116	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	4.2E-16	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.11E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MGRKPCCDKA HTNRGAWTKE EDDRLIEYIR MNGHGSWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDVKRGNF TIDEDELIIK LHKLLGNKWS LIAGRLPGRT DNEIKNHWNT HIRRRLLRGG 120 IDPKTHQPTK PTTTEEGNCS SALTAATIDG AEKPPQPPPE QQPNQFPDGE EEHVNLELTL 180 ALFPTPSEST AESKLRRTTA PDGPDEDAGA CVGCCQLSNE DSHQCQKCYN QDFNLTL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-29	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM442379	0.0	AM442379.2 Vitis vinifera contig VV78X123743.4, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019071955.1	1e-177	PREDICTED: myb-related protein 308-like
Swissprot	P81393	3e-77	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	6e-77	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A438E138	1e-174	A0A438E138_VITVI; Myb-related protein 308
STRING	VIT_18s0117g00210.t01	1e-157	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	2e-74	myb domain protein 6

Link Out ? help Back to Top
Phytozome	GSVIVT01012777001

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]