![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01013107001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 89aa MW: 10334.7 Da PI: 10.3177 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 75.4 | 9.8e-24 | 1 | 68 | 9 | 79 |
HHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSE CS
HSF_DNA-bind 9 iledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiw 79
+++d+++++++sws ++nsfvv+++ efa+++LpkyFkh+nf+SFvRQLn+Y k ek+ kek
GSVIVT01013107001 1 MVDDPATNSIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQLNTYHPKTEVGMEKQ---KEKKA 68
899***********999***********************************86655444444...33334 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 1.4E-20 | 1 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 6.39E-22 | 1 | 53 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 1.4E-20 | 1 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PROSITE profile | PS50061 | 8.648 | 1 | 71 | IPR000418 | Ets domain |
| Gene3D | G3DSA:1.10.10.10 | 1.0E-24 | 1 | 70 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 3.1E-6 | 32 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.1E-6 | 45 | 57 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MVDDPATNSI VSWSPTNNSF VVWNPPEFAR DLLPKYFKHN NFSSFVRQLN TYHPKTEVGM 60 EKQKEKKARF RDSGRLIQTV GNLQMRDF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 4e-18 | 1 | 62 | 36 | 97 | Heat shock factor protein 1 |
| 5d5v_B | 4e-18 | 1 | 62 | 36 | 97 | Heat shock factor protein 1 |
| 5d5v_D | 4e-18 | 1 | 62 | 36 | 97 | Heat shock factor protein 1 |
| 5hdg_A | 3e-18 | 1 | 62 | 17 | 78 | Heat shock factor protein 1 |
| 5hdn_A | 3e-18 | 1 | 62 | 17 | 78 | Heat shock factor protein 1 |
| 5hdn_B | 3e-18 | 1 | 62 | 17 | 78 | Heat shock factor protein 1 |
| 5hdn_C | 3e-18 | 1 | 62 | 17 | 78 | Heat shock factor protein 1 |
| 5hdn_D | 3e-18 | 1 | 62 | 17 | 78 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FQ392254 | 1e-147 | FQ392254.1 Vitis vinifera clone SS0AFA6YK04. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003631489.1 | 9e-30 | PREDICTED: heat shock factor protein HSF8 | ||||
| Swissprot | P41153 | 3e-28 | HSF8_SOLPE; Heat shock factor protein HSF8 | ||||
| Swissprot | Q40152 | 3e-28 | HSF8_SOLLC; Heat shock factor protein HSF8 | ||||
| TrEMBL | A0A438JZF0 | 2e-30 | A0A438JZF0_VITVI; Heat stress transcription factor A-1a | ||||
| STRING | VIT_02s0012g01810.t01 | 3e-29 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP96 | 17 | 233 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17750.1 | 3e-30 | heat shock factor 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01013107001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




