PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01013778001

Common Name

VIT_01s0127g00330

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

YABBY

Protein Properties

Length: 177aa MW: 19559.3 Da PI: 7.472

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01013778001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	207.3	5.7e-64	6	164	2	167
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnveke 89 ++f+ eq+CyvqC+fC+til+vsvP++sl++vvtvrCGhC+sllsvn++kas +lla+ s+ + +e + +e+ ++ + + GSVIVT01013778001 6 HLFDLQEQICYVQCGFCTTILLVSVPYSSLSMVVTVRCGHCASLLSVNMMKASfvplHLLASLSQ-------DEPKE-GCPNEEGAQKASDK 89 78999******************************************9998444444444443.......21122.22222222222333 PP YABBY 90 esastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkih 167 +s+s ss +++ed+ vp + v++PPekrqr+Psaynrfikeei+r+ka+nP+++h+eafs+aaknWahfP i GSVIVT01013778001 90 RSPSMVASS---DNEEDDIVPVHHVVNKPPEKRQRAPSAYNRFIKEEIRRLKAENPKMTHKEAFSTAAKNWAHFPAIQ 164 333333333...34455556655669***********************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	7.3E-65	11	165	IPR006780	YABBY protein
SuperFamily	SSF47095	3.14E-9	111	161	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	1.0E-6	114	161	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MSTLNHLFDL QEQICYVQCG FCTTILLVSV PYSSLSMVVT VRCGHCASLL SVNMMKASFV 60 PLHLLASLSQ DEPKEGCPNE EGAQKASDKR SPSMVASSDN EEDDIVPVHH VVNKPPEKRQ 120 RAPSAYNRFI KEEIRRLKAE NPKMTHKEAF STAAKNWAHF PAIQLKGAGE SCSQER*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First detected in a group of around 15 epidermal cells on the abaxial half of each ovule primordium (chalaza, outer integument initiation sites). Later present in the outer cell layer of the outer integument on the abaxial side of the ovule primordium. Confined to the chalazal end of the integument and disappears after anthesis. Also present in embryos at the globular stage. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Functional Description ? help Back to Top
Source	Description
UniProt	Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:9093862, ECO:0000269\|PubMed:9118807}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM438239	3e-69	AM438239.2 Vitis vinifera contig VV78X010071.10, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010651541.1	1e-131	PREDICTED: axial regulator YABBY 4 isoform X2
Swissprot	Q9LDT3	7e-72	YAB4_ARATH; Axial regulator YABBY 4
TrEMBL	D7TDI7	1e-129	D7TDI7_VITVI; Uncharacterized protein
STRING	VIT_01s0127g00330.t01	1e-130	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP9612	7	12

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23420.1	3e-74	YABBY family protein

Link Out ? help Back to Top
Phytozome	GSVIVT01013778001

Publications ? help Back to Top
Lora J,Hormaza JI,Herrero M Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] Skinner DJ,Brown RH,Kuzoff RK,Gasser CS Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function. BMC Plant Biol., 2016. 16(1): p. 143 [PMID:27350128] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961]