![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01014154001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 107aa MW: 11846.5 Da PI: 10.2377 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 194.9 | 2.8e-60 | 3 | 102 | 2 | 101 |
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93
++ r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sasasp+ss
GSVIVT01014154001 3 SGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIVGGSASASPCSS 94
789***************************************************************************************** PP
DUF822 94 lqsslkss 101
++ s++s
GSVIVT01014154001 95 YHPSPSSP 102
**887775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 2.0E-57 | 4 | 104 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MTSGARLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG 60 WTVEPDGTTY RKGCKPVERM DIVGGSASAS PCSSYHPSPS SPSIHP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.21849 | 1e-163 | bud| flower | ||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM426448 | 1e-114 | AM426448.2 Vitis vinifera contig VV78X198422.9, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010644097.1 | 2e-67 | PREDICTED: BES1/BZR1 homolog protein 4 | ||||
| Swissprot | Q9ZV88 | 1e-43 | BEH4_ARATH; BES1/BZR1 homolog protein 4 | ||||
| TrEMBL | A0A067DLE1 | 2e-65 | A0A067DLE1_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5Q4X7 | 2e-65 | A0A2H5Q4X7_CITUN; Uncharacterized protein | ||||
| TrEMBL | F6H1V6 | 2e-61 | F6H1V6_VITVI; Uncharacterized protein | ||||
| TrEMBL | V4TV52 | 2e-65 | V4TV52_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006477843.1 | 3e-66 | (Citrus sinensis) | ||||
| STRING | VIT_19s0014g00870.t01 | 3e-62 | (Vitis vinifera) | ||||
| STRING | XP_006442380.1 | 3e-66 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP1595 | 15 | 42 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G78700.1 | 2e-34 | BES1/BZR1 homolog 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01014154001 |




