PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01015102001

Common Name

VIT_11s0016g01320

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

MYB

Protein Properties

Length: 244aa MW: 27255.7 Da PI: 8.8908

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01015102001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.7	1e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed++l ++v+ +G g W+ +++ g++R++k+c++rw++yl GSVIVT01015102001 14 RGSWSAWEDKILCNYVEVHGEGKWRDLPQRAGLKRCGKSCRLRWLNYL 61 89********************************************97 PP
2	Myb_DNA-binding	53.8	4.3e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ GSVIVT01015102001 67 RGNISSEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111 7899****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.3E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.08	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	6.12E-28	12	108	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.9E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	3.51E-9	16	61	No hit	No description
PROSITE profile	PS51294	25.328	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.8E-25	65	116	IPR009057	Homeodomain-like
SMART	SM00717	3.9E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	5.4E-15	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	2.89E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 244 aa Download sequence Send to blast
MGRRPCCAKE GLNRGSWSAW EDKILCNYVE VHGEGKWRDL PQRAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI SSEEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKRLQASK 120 GQNSPNKKVE NPKNQTSGTG KSSAEPHTVI RTRAVRCSKV IIPRVQADFD ENPSPKMAVP 180 TSEPSSSALE QGETANFFMG FDIGDLLTSD ALNSFLDQDE EMGENNSNGV SDLFPPCGRQ 240 LPN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-24	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis.
Uniprot	TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269\|PubMed:15361138}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU919682	0.0	EU919682.1 Vitis vinifera MybPA2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001267953.1	1e-174	uncharacterized protein LOC100264512
Swissprot	Q9FJA2	3e-63	TT2_ARATH; Transcription factor TT2
TrEMBL	F6HGP6	1e-174	F6HGP6_VITVI; Uncharacterized protein
STRING	VIT_11s0016g01320.t01	1e-175	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	2e-61	MYB family protein

Link Out ? help Back to Top
Phytozome	GSVIVT01015102001

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Liu C,Jun JH,Dixon RA MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula. Plant Physiol., 2014. 165(4): p. 1424-1439 [PMID:24948832] Zhu Z, et al. Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation. J. Exp. Bot., 2015. 66(13): p. 3775-89 [PMID:25911741] Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao. BMC Plant Biol., 2015. 15: p. 160 [PMID:26109181] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Li C,Zhang B,Chen B,Ji L,Yu H Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds. Nat Commun, 2018. 9(1): p. 571 [PMID:29422671]