PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01017901001

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

NF-YC

Protein Properties

Length: 105aa MW: 11582.2 Da PI: 9.2879

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01017901001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	45.5	1.7e-14	5	39	67	101
NF-YC 67 eenkrrtlkksdiaaavtrtdifdflvdivprdel 101 e+nkrrtl+k+diaaa+trtdifdflvdivpr++l GSVIVT01017901001 5 EDNKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 39 789*****************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.51E-7	4	36	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	1.4E-10	5	36	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MKADEDNKRR TLQKNDIAAA ITRTDIFDFL VDIVPREDLK DEVLASIPRG GPLPVGGPAE 60 GLPYFYMQPQ HGPQVGAPGM SRSKNNKCQG RRCLTSIEMN RRNT*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	8	14	RRTLQKN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.2416	1e-121	bud\| fruit\| inflorescence\| leaf\| pedicel

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269\|PubMed:11867211, ECO:0000269\|PubMed:17322342}.

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269\|PubMed:25105952}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM473047	1e-118	AM473047.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X051089.14, clone ENTAV 115.
GenBank	FQ380218	1e-118	FQ380218.1 Vitis vinifera clone SS0ADG1YB12.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002280741.1	4e-49	PREDICTED: nuclear transcription factor Y subunit C-3
Swissprot	Q8L4B2	2e-25	NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBL	A0A438F6C0	9e-48	A0A438F6C0_VITVI; Nuclear transcription factor Y subunit C-9
TrEMBL	F6HDM1	9e-48	F6HDM1_VITVI; Uncharacterized protein
STRING	VIT_05s0020g02790.t01	1e-48	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP315	17	117

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08970.4	6e-28	nuclear factor Y, subunit C9

Link Out ? help Back to Top
Phytozome	GSVIVT01017901001

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Liu X, et al. The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis. Nat Commun, 2016. 7: p. 12768 [PMID:27624486] Myers ZA, et al. NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana. PLoS Genet., 2016. 12(9): p. e1006333 [PMID:27685091] Tang Y, et al. Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation. Mol Plant, 2017. 10(2): p. 260-273 [PMID:27876642] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714] Bi C,Ma Y,Wang XF,Zhang DP Overexpression of the transcription factor NF-YC9 confers abscisic acid hypersensitivity in Arabidopsis. Plant Mol. Biol., 2017. 95(4-5): p. 425-439 [PMID:28924726] Liu X, et al. Temporal-Specific Interaction of NF-YC and CURLY LEAF during the Floral Transition Regulates Flowering. Plant Physiol., 2018. 177(1): p. 105-114 [PMID:29599268]