![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01017901001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 105aa MW: 11582.2 Da PI: 9.2879 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 45.5 | 1.7e-14 | 5 | 39 | 67 | 101 |
NF-YC 67 eenkrrtlkksdiaaavtrtdifdflvdivprdel 101
e+nkrrtl+k+diaaa+trtdifdflvdivpr++l
GSVIVT01017901001 5 EDNKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 39
789*****************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.51E-7 | 4 | 36 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-10 | 5 | 36 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MKADEDNKRR TLQKNDIAAA ITRTDIFDFL VDIVPREDLK DEVLASIPRG GPLPVGGPAE 60 GLPYFYMQPQ HGPQVGAPGM SRSKNNKCQG RRCLTSIEMN RRNT* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 8 | 14 | RRTLQKN |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.2416 | 1e-121 | bud| fruit| inflorescence| leaf| pedicel | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269|PubMed:11867211, ECO:0000269|PubMed:17322342}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM473047 | 1e-118 | AM473047.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X051089.14, clone ENTAV 115. | |||
| GenBank | FQ380218 | 1e-118 | FQ380218.1 Vitis vinifera clone SS0ADG1YB12. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002280741.1 | 4e-49 | PREDICTED: nuclear transcription factor Y subunit C-3 | ||||
| Swissprot | Q8L4B2 | 2e-25 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
| TrEMBL | A0A438F6C0 | 9e-48 | A0A438F6C0_VITVI; Nuclear transcription factor Y subunit C-9 | ||||
| TrEMBL | F6HDM1 | 9e-48 | F6HDM1_VITVI; Uncharacterized protein | ||||
| STRING | VIT_05s0020g02790.t01 | 1e-48 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP315 | 17 | 117 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08970.4 | 6e-28 | nuclear factor Y, subunit C9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01017901001 |




