PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01020050001

Common Name

VIT_01s0026g01820

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

SBP

Protein Properties

Length: 117aa MW: 13214 Da PI: 10.5392

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01020050001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	49.1	1.5e-15	24	55	47	78
SSEEETTT--SS--S-STTTT-------S--- CS SBP 47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78 rfh l+efDe+krsC+rrLa+hn+rrrk+++ GSVIVT01020050001 24 LRFHVLQEFDEGKRSCQRRLAGHNKRRRKTHP 55 59***************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	12.622	1	53	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	5.4E-5	24	40	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.88E-12	25	58	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.3E-8	25	52	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MLMSTLLGKS NEISLKKIQK ENALRFHVLQ EFDEGKRSCQ RRLAGHNKRR RKTHPDVADN 60 GNSLNDDQAS GYLLISLLRI LSNVHPNNKS DQTKDQDLLS HILRSLARCS FHPNIG*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	47	53	KRRRKTH

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.5619	1e-104	bud\| flower\| fruit\| inflorescence\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269\|PubMed:10524240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269\|PubMed:16554053}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM473856	1e-148	AM473856.2 Vitis vinifera contig VV78X042896.5, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021676155.1	1e-37	squamosa promoter-binding-like protein 1 isoform X1
Refseq	XP_021676156.1	1e-37	squamosa promoter-binding-like protein 1 isoform X2
Refseq	XP_021676159.1	1e-37	squamosa promoter-binding-like protein 1 isoform X4
Swissprot	Q9S7P5	2e-34	SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBL	D7TNC7	7e-79	D7TNC7_VITVI; Uncharacterized protein
STRING	VIT_01s0026g01820.t01	1e-79	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G60030.1	8e-37	squamosa promoter-binding protein-like 12

Link Out ? help Back to Top
Phytozome	GSVIVT01020050001

Publications ? help Back to Top
Jung S, et al. Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes. BMC Genomics, 2006. 7: p. 81 [PMID:16615871] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Chao LM, et al. Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323]