PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01021087001

Common Name

LOC100250271, VIT_10s0003g00050

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

SBP

Protein Properties

Length: 141aa MW: 15724.5 Da PI: 8.1499

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01021087001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	138.4	2.1e-43	56	132	2	78
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqv++C+ad+seak+yh+rh+vCe+h+kapv+l++g++qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk+++ GSVIVT01021087001 56 CQVDNCTADMSEAKRYHKRHRVCEHHAKAPVILIAGIQQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSS 132 **************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	1.2E-62	1	140	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	2.0E-36	48	117	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.582	53	130	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	9.22E-40	54	133	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.0E-34	56	129	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MEMSKAQGKR TLMEEEEEDD EDTVGLGFGE DEKKKKAVTL TNKKGSGGAG STPPSCQVDN 60 CTADMSEAKR YHKRHRVCEH HAKAPVILIA GIQQRFCQQC SRFHELSEFD DTKRSCRRRL 120 AGHNERRRKS SSESHGEGSS *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	5e-38	47	129	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM456675	1e-169	AM456675.2 Vitis vinifera contig VV78X102566.12, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002280052.1	1e-100	PREDICTED: squamosa promoter-binding protein 1 isoform X2
Swissprot	Q38741	2e-52	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	D7TJB9	1e-98	D7TJB9_VITVI; Squamosa promoter-binding-like protein
STRING	VIT_10s0003g00050.t01	2e-99	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	3e-42	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Phytozome	GSVIVT01021087001
Entrez Gene	100250271

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]