PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01022613001
Common NameVIT_02s0033g00050
Organism
Vitis vinifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family GRAS
Protein Properties Length: 95aa    MW: 10354.8 Da    PI: 4.6403
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01022613001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS45.11.7e-144493150
               GRAS  1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALa 50
                       l++lLl+cA++v+s++le+ + +++++s+las dgd+mq +aayft+ALa
  GSVIVT01022613001 44 LIHLLLTCANHVASSSLENMNIAMEQISQLASVDGDTMQCIAAYFTKALA 93
                       689**********************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.9691894IPR005202Transcription factor GRAS
PfamPF035145.7E-124493IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MDERSSSVTS SPLQLFSMMS HSPSLGSPYP WLRELKSEER GLYLIHLLLT CANHVASSSL  60
ENMNIAMEQI SQLASVDGDT MQCIAAYFTK ALAD*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4541281e-146AM454128.2 Vitis vinifera contig VV78X093241.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266911.32e-51PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-33SCL3_ARATH; Scarecrow-like protein 3
TrEMBLD7U3Q11e-62D7U3Q1_VITVI; Uncharacterized protein
STRINGVIT_02s0033g00050.t012e-63(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-36scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]