PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSVIVT01023089001

Common Name

VIT_04s0069g01150

Organism

Vitis vinifera

Taxonomic ID

29760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis

Family

bZIP

Protein Properties

Length: 58aa MW: 7170.25 Da PI: 10.9313

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSVIVT01023089001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	48.4	2e-15	8	51	5	48
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 +r++r++kN e+A+ sR+RK+a++ eLe+kv Le+eN++L+k+ GSVIVT01023089001 8 RRQKRMIKNWESATHSRARKQAYTNELENKVSRLEEENERLRKR 51 69****************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	7.5E-5	4	55	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.392	6	51	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.0E-13	8	51	No hit	No description
Pfam	PF00170	2.9E-13	8	51	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	6.88E-11	8	51	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 58 aa Download sequence Send to blast
MIEKTIERRQ KRMIKNWESA THSRARKQAY TNELENKVSR LEEENERLRK RKVYIFF*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Vvi.24690	4e-75	cell culture\| flower\| fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269\|PubMed:15642716}.
Uniprot	TISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269\|PubMed:12376636}.

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM426555	2e-43	AM426555.2 Vitis vinifera contig VV78X160260.4, whole genome shotgun sequence.
GenBank	AM435475	2e-43	AM435475.1 Vitis vinifera contig VV78X054728.11, whole genome shotgun sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018842402.1	4e-23	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
Swissprot	Q9C5Q2	7e-19	AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBL	D7T0G0	2e-30	D7T0G0_VITVI; Uncharacterized protein
STRING	VIT_04s0069g01150.t01	3e-31	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP10063	7	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56850.1	9e-14	ABA-responsive element binding protein 3

Link Out ? help Back to Top
Phytozome	GSVIVT01023089001

Publications ? help Back to Top
Haas BJ, et al. Full-length messenger RNA sequences greatly improve genome annotation. Genome Biol., 2002. 3(6): p. RESEARCH0029 [PMID:12093376] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153]