![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01025075001 | ||||||||
| Common Name | VIT_06s0004g03780 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 133aa MW: 15748 Da PI: 10.4426 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 66.4 | 3.9e-21 | 7 | 66 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
+R+++t+eql +Lee+++ r+p+a+++++++++l +++ ++V++WFqN++a++++
GSVIVT01025075001 7 SRWCPTPEQLMILEEMYRGgVRTPNASQIQQITAHLsfygKIEGKNVFYWFQNHKARDRQ 66
7*****************99*************************************996 PP
| |||||||
| 2 | Wus_type_Homeobox | 122.2 | 2.1e-39 | 5 | 67 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
a++RW+PtpeQ++iLee+y+ G+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
GSVIVT01025075001 5 ASSRWCPTPEQLMILEEMYRGGVRTPNASQIQQITAHLSFYGKIEGKNVFYWFQNHKARDRQK 67
689***********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.009 | 2 | 67 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.4E-4 | 4 | 71 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 6.7E-8 | 7 | 66 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.15E-11 | 7 | 66 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 6.4E-19 | 7 | 66 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 3.45E-4 | 8 | 67 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008283 | Biological Process | cell proliferation | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0009943 | Biological Process | adaxial/abaxial axis specification | ||||
| GO:0009947 | Biological Process | centrolateral axis specification | ||||
| GO:0010865 | Biological Process | stipule development | ||||
| GO:0048513 | Biological Process | animal organ development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MSPAASSRWC PTPEQLMILE EMYRGGVRTP NASQIQQITA HLSFYGKIEG KNVFYWFQNH 60 KARDRQKLRR KLSKQLQQQQ QFHQHHHQPL QQQNQRNQPL LHYLDPPVYS AFHQLFNYNT 120 SPFLPQVILI LI* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:14711878}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269|PubMed:11751640}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM429035 | 0.0 | AM429035.2 Vitis vinifera contig VV78X068576.4, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002281707.1 | 1e-89 | PREDICTED: WUSCHEL-related homeobox 3 | ||||
| Swissprot | Q9SIB4 | 2e-44 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
| TrEMBL | D7SKP4 | 2e-92 | D7SKP4_VITVI; Uncharacterized protein | ||||
| STRING | VIT_06s0004g03780.t01 | 3e-93 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5580 | 11 | 21 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28610.1 | 3e-40 | WOX family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01025075001 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




