![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSVIVT01025155001 | ||||||||
| Common Name | LOC100248443, VIT_06s0004g03160 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 90aa MW: 9935.84 Da PI: 10.3053 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 131.8 | 1.8e-41 | 24 | 89 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++akG+nPGlivll+v glllvflvgny+lyvyaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe
GSVIVT01025155001 24 DADAKGFNPGLIVLLLVVGLLLVFLVGNYALYVYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 89
6789*************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 0.001 | 21 | 89 | No hit | No description |
| Pfam | PF04689 | 2.5E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MEEDFEFADK VPPSFERMGN VIKDADAKGF NPGLIVLLLV VGLLLVFLVG NYALYVYAQK 60 TLPPRKKKPV SKKKMKKERL KQGVSAPGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Vvi.2461 | 1e-140 | bud| fruit| inflorescence| leaf| stem | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FQ385037 | 1e-149 | FQ385037.1 Vitis vinifera clone SS0AEB3YJ10. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002285012.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
| Refseq | XP_010651138.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
| Refseq | XP_010651139.1 | 3e-57 | PREDICTED: DNA-binding protein S1FA | ||||
| Swissprot | Q7XLX6 | 2e-16 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | D7SKV6 | 6e-56 | D7SKV6_VITVI; Uncharacterized protein | ||||
| STRING | VIT_06s0004g03160.t01 | 1e-56 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5095 | 13 | 22 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GSVIVT01025155001 |
| Entrez Gene | 100248443 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




